PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016490986.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 311aa    MW: 35010 Da    PI: 8.0165
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016490986.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer106.41.7e-33101158260
     ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                     +++rYkeClkNhAaslGgh++DGCgEfmps geegt++ lkCaAC+CHRnFHR+e+e+e
  XP_016490986.1 101 SSIRYKECLKNHAASLGGHVLDGCGEFMPS-GEEGTPEYLKCAACDCHRNFHRKETEDE 158
                     5789*************************9.999*********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-21102156IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.8E-31103155IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.8E-31104154IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.172105154IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.17E-16244308IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-27244309IPR009057Homeodomain-like
TIGRFAMsTIGR015659.1E-25247304IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MEHTGQDKDM GMPNCIGFNS SHLNQQESTP FAAAKLPTAP IVSSLPDRTR NEQISHGNTI  60
FSPNQTLDHQ HNLTPNSDPD PTIIAAQLRQ QSTTSASDRN SSIRYKECLK NHAASLGGHV  120
LDGCGEFMPS GEEGTPEYLK CAACDCHRNF HRKETEDELQ TAGVYRNNSN SHRVHIQTPP  180
SLPVPPQQQH HHKYSHNYSR GPMPPVMMNF GGNTGVPAES SSEDLNMFHS NAGGQGVIQP  240
CAFSVSKKRF RTKFTQQQKE KMQEFAEKLE WRIQKQDEQE VQQFCNEVGV KRQVFKVFMH  300
NCKQAIKRKQ T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-202483031873ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016490986.10.0PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW75e-66ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLM0ZVH11e-164M0ZVH1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000090331e-163(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.13e-67homeobox protein 24